Recombinant Aquifex aeolicus Uncharacterized protein aq_1618 (aq_1618)

Code CSB-CF524748DNV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O67545
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Aquifex aeolicus (strain VF5)
Sequence MDFLRKLPLGLTIHLSLFLLSLLYALNAGRLPELKDYIIYFKVRLEGQWELSEDGVSAPV FVEESEIEFLKGRKAFLFVKKARYIPKGSRFELFGNVRVKKNRVFISAYIWDLERLPEKK NIRDFLMEKFKEKVKDEHLRAIGLAFLFGESKRNLPAEVERVFLHTGLIHVLVVSGLHVG LVFLILSRLLPRFYGEVLGLVGVLFYSAFLVPHNPPVIRATSMLFLWVLSFLSFRRYCSL CVLFFTGTLMLFFFPHFSYSYSFWLSFFAVLYILLVLKDFEGGNTSKALMVSLGAFTGTA PLIASFSFVTPLSVLLTPVLSPLIFAYALFGVLSLLTLFSFPPSLILMNLSGELIFRVLE FFSDFSPKILSNVKPEEAFILLILGAIGLYVTKGYSKLLPLGVVNLYLIFKIN
Source in vitro E.coli expression system
Gene Names aq_1618
Protein Names Recommended name: Uncharacterized protein aq_1618
Expression Region 1-413
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: aae:aq_1618

STRING: 224324.aq_1618

Related Products

aq_1618 Proteins

aq_1618 Proteins for Aquifex aeolicus (strain VF5)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.