Recombinant Archaeoglobus fulgidus Molybdate/tungstate transport system permease protein wtpB(wtpB)

Code CSB-CF521660DOC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O30143
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Sequence MRLLFSALLALLSSIILLFVLLPVAATVTLQLFNFDEFLKAASDPAVWKVVLTTYYAALI STLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSFS PLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPL SVRHIVAGAIMSWARGISEFGAVVVIAYYPMIAPTLIYERYLSEGLSAAMPVAAILILLS LAVFVALRIIVGREDVSEGQG
Source in vitro E.coli expression system
Gene Names wtpB
Protein Names Recommended name: Molybdate/tungstate transport system permease protein wtpB
Expression Region 1-261
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the ABC transporter complex WtpABC involved in molybdate/tungstate import. Probably responsible for the translocation of the substrate across the membrane (Probable).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Binding-protein-dependent transport system permease family
Database Links

KEGG: afu:AF_0093

STRING: 224325.AF0093

Related Products

wtpB Proteins

wtpB Proteins for Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.