Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2401 (AF_2401)

Code CSB-CF516211DOC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O30270
Storage Buffer Tris-based buffer,50% glycerol
Species Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Sequence MRLNKLISGLGLAFAIYFFLLNQERLFGEVFVVADEMQRAALLTLIVAYSALASVERLNP FRLVLVPFILIVSSDITFNSLLSHGYPQYFVVYQSVRGYIAIFSGSFAFSYIRFTDKPLY QSLISATSLGIAGLSSYYLFSYLSEVFGLPSLALPSLALFLILAVTALSTAFEGEVFQWI RSERTFLMLVLFILTFYTLAIKPQLSERPGIADFIEWSIVALTFIKISRDFRRSVEVDER EFIASHVPKERVFRDRLYSELEFGEKAFVEGGSKVPLTIALVRALSNVEAPKLAAILAPL ISYEDEKLPALSFPWERRIIESRNRRRREKVVERIRAEVMREVKDFNR
Source in vitro E.coli expression system
Gene Names AF_2401
Protein Names Recommended name: Uncharacterized protein AF_2401
Expression Region 1-348
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: afu:AF_2401

STRING: 224325.AF2401

Related Products

AF_2401 Proteins

AF_2401 Proteins for Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.