Recombinant Aspergillus niger Bifunctional lycopene cyclase/phytoene synthase (An07g00800)

Code CSB-CF382712AVE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2QM49
Storage Buffer Tris-based buffer,50% glycerol
Species Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Sequence MNQNGTRLCYSVREVPPTSFVSAPANYKRASSHCTYTIPAASALTVLYYPFFTAQDRCKI CILITIAILATLPWDSYLIRSAIWTYPPDAVVGLKILDIPIEEVFFFAIQTYITSLTYCI FTKPLVRPMYLRSHLERRGTRYVVATVILALMGGGTACLLLGRRMTYLGLILVWACPILL FQWMMSYPFLSELPWKPTITSICLPTLHLWFADSRAMGTGTWRIEEGTKLNFRIGGLELE EALFFLVSNMMVVLGLVGCDYAYALQEYESLSQPASDVYITLRKALSLLARPLPIDASLI SALSQAVYRLQEKSQSMFLGSALFQGQLRIDLIFLYSFCRVMDDLIDEAEDEQEARFWVT ECRHLLDSTHRSEPHSDHFYTGKKGEEHERLRQSISYLPPSHLSNDSFDDLLKGFEIDLK FNPQREAFPIQSEYCLDQYAGFVAGTVGVLVFDLTLFHCGHYFIQDVPRLRRAAKDMGKA MQCQPRGDGGATSGRKRAIAGNRGELYGYWTTAEGAERHKPGASVEDEGAFGATAKSWLA GDVITELCHCFIQAEYVIYLVRHQNASADTLVLLSALVYRLE
Source in vitro E.coli expression system
Gene Names An07g00800
Protein Names Recommended name: Bifunctional lycopene cyclase/phytoene synthase Including the following 2 domains: Lycopene beta-cyclase EC= 5.5.1.19 Alternative name(s): Lycopene cyclase Phytoene synthase EC= 2.5.1.32
Expression Region 1-582
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Bifunctional enzyme that catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Lycopene beta-cyclase family; Phytoene/squalene synthase family

Related Products

An07g00800 Proteins

An07g00800 Proteins for Aspergillus niger (strain CBS 513.88 / FGSC A1513)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.