Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF478687BQL |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | B7HWG2 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Bacillus cereus (strain AH187) |
| Sequence | MAKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGSLIYNDKNEVIGSKLI GQNFTDPRYFHGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSIEEWKKQNPSVPVTEVP IDLVTNSGSGLDPDISPKAASVQVERISKITNIPKETLNQLIKDQTEGAALGLFGENRVN VLKLNLELQKLMK |
| Source | in vitro E.coli expression system |
| Gene Names | kdpC |
| Protein Names | Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain |
| Expression Region | 1-193 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex. |
| Subcellular Location | Cell membrane, Single-pass membrane protein |
| Protein Families | KdpC family |
| Database Links |
KEGG: bcr:BCAH187_A0896 |
kdpC Proteins for Bacillus cereus (strain AH187)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP478687BQL1 CSB-EP478687BQL1 CSB-BP478687BQL1 CSB-MP478687BQL1 |
Recombinant Bacillus cereus Potassium-transporting ATPase C chain(kdpC) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse Sex-determining region Y protein(Sry),partial
Express system: E.coli
Species: Mus musculus (Mouse)
-SDS.jpg)
Recombinant Human Collagen alpha-1(XI) chain,partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Vascular endothelial growth factor A(Vegfa)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human E3 ubiquitin-protein ligase TRIM21(TRIM21)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Mast cell carboxypeptidase A(CPA3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human B-lymphocyte antigen CD19(CD19),partial
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
