Recombinant Bacillus clausii Zinc metalloprotease rasP(rasP)

Code CSB-CF733207BAAC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5WFT5
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus clausii (strain KSM-K16)
Sequence MNTLLAFIAIFSVLVFVHEWGHLYFAKKAGILCYEFAIGMGPKLFAFERNDTIYTIRLLP IGGYVRMAGEEPEQPTIRPGYEIGLVLDEKDTVKELIVNNKSKHPEAQVVQVERIDLVHD LFVETIDEDTGELVRYPIDEKAFIVQDEVAQIIAPWKRQFGSKPLPKRAMAIFAGPLMNF ILGFVILLGLSLYQGVTLSSEIVINGENSPAEAAGLQDGDVITAVNGVEVDSWKEMTTEV KKYPGEEVSIDYERNGEALQTNATLSQVEVMPDEYEGFLGVSGVPEFSLLGSLQYAGNEF INMATSIFDTLGLIFTGQFSLDYISGPVGIYDITDQAVSLGIQTVIFFAALLSINLGVIN LMPIPALDGGRLMFLAYEGIRGKPVSPEKEGAIQFIGFALVMLLMIVVTWNDISKLFS
Source in vitro E.coli expression system
Gene Names rasP
Protein Names Recommended name: Zinc metalloprotease rasP EC= 3.4.24.- Alternative name(s): Regulating alternative sigma factor protease Regulating anti-sigma-W factor activity protease
Expression Region 1-418
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Is responsible for Site-2 cleavage of the RsiW anti-sigma factor. This results, after a third proteolytic step catalyzed by the ClpXP protease, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: bcl:ABC2235

STRING: 66692.ABC2235

Related Products

rasP Proteins

rasP Proteins for Bacillus clausii (strain KSM-K16)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.