Recombinant Bacillus licheniformis Protease prsW(prsW)

Code CSB-CF714636BQU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q65I04
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Sequence MFGIISAGLAPGIALLMYFYLKEKYESEPIHMVIRLFILGVLLVFPTMFIQYVLEKEHIS EGSFVVSFLTSGFLEEFLKWFLLMVSTFQHIDFDEHYDGIVYGTSLSLGFATLENILYLI GNGVEYAFMRALLPVSSHALFGVIMGFYIGKARFSDSKTKMKWLLCSLFIPALLHGLYDY ILLALKNWIYFMLPFMAFLWWFGLRKAKKARSVKTGGQPLQQ
Source in vitro E.coli expression system
Gene Names prsW
Protein Names Recommended name: Protease prsW EC= 3.4.-.- Alternative name(s): Protease responsible for activating sigma-W
Expression Region 1-222
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the degradation of specific anti-sigma factors. Responsible for Site-1 cleavage of the RsiW anti-sigma factor. This results, after two other proteolytic steps catalyzed by the RasP and ClpXP proteases, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Protease PrsW family
Database Links

KEGG: bld:BLi02432

STRING: 279010.BLi02432

Related Products

prsW Proteins

prsW Proteins for Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.