Recombinant Bacillus subtilis Fatty acid desaturase(des)

Code CSB-CF523526BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O34653
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MTEQTIAHKQKQLTKQVAAFAQPETKNSLIQLLNTFIPFFGLWFLAYLSLDVSYLLTLAL TVIAAGFLTRIFIIFHDCCHQSFFKQKRYNHILGFLTGVLTLFPYLQWQHSHSIHHATSS NLDKRGTGDIWMLTVNEYKAASRRTKLAYRLYRNPFIMFILGPIYVFLITNRFNKKGARR KERVNTYLTNLAIVALAAACCLIFGWQSFLLVQGPIFLISGSIGVWLFYVQHTFEDSYFE ADENWSYVQAAVEGSSFYKLPKLLQWLTGNIGYHHVHHLSPKVPNYKLEVAHEHHEPLKN VPTITLKTSLQSLAFRLWDEDNKQFVSFRAIKHIPVSLPPDSPEKQKLRKNA
Source in vitro E.coli expression system
Gene Names des
Protein Names Recommended name: Fatty acid desaturase EC= 1.14.19.- Alternative name(s): Delta(5) acyl-lipid desaturase Delta(5) desaturase
Expression Region 1-352
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the introduction of a cis-double bond at the delta(5) position of existing saturated fatty acids attached to membrane phospholipids. It is not strictly specific for palmitic acid (C16) but can also accept C14 as well as C18 species to yield unsaturated fatty acids.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Fatty acid desaturase type 1 family
Database Links

KEGG: bsu:BSU19180

STRING: 224308.Bsubs1_010100010586

Related Products

des Proteins

des Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.