Recombinant Bacillus subtilis Protein xhlA(xhlA)

Code CSB-CF336628BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P39798
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Bacillus subtilis (strain 168)
Sequence MQQEADVNVFQQDLADMKGEHKALEQRVSALERVSDRQDQQIMTLNEKLNKIEENTTWIK RTITGAIITAVSTGIIGGAIAIMYSLLQH
Source in vitro E.coli expression system
Gene Names xhlA
Protein Names Recommended name: Protein xhlA
Expression Region 1-89
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Associated with cell lysis upon induction of PbsX.
Subcellular Location Cell membrane, Single-pass membrane protein
Database Links

KEGG: bsu:BSU12790

STRING: 224308.Bsubs1_010100007091

Related Products

xhlA Proteins

xhlA Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.