Recombinant Bacillus subtilis Putative multidrug export ATP-binding/permease protein YgaD(ygaD)

Code CSB-CF300302BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P71082
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSL FTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGE VISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVK YFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIR HTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLIN SSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHD VSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGM VLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLS GGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTI THADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
Source in vitro E.coli expression system
Gene Names ygaD
Protein Names Recommended name: Putative multidrug export ATP-binding/permease protein YgaD EC= 3.6.3.-
Expression Region 1-580
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in multidrug export. Transmembrane domains (TMD) form a pore in the cell membrane and the ATP-binding domain (NBD) is responsible for energy generation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily
Database Links

KEGG: bsu:BSU08690

STRING: 224308.Bsubs1_010100004813

Related Products

ygaD Proteins

ygaD Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.