Recombinant Bacillus subtilis Signaling protein ykoW(ykoW)

Code CSB-CF520193BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O34311
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MEIHVTYNTTLICLSILIACTASYISLELSRKVTINTGLKSKIWLIGGSLIMGFGIWSMH FVGMMAVHMEMPMEYEFMPLMAAIGASVSGSFVSLYFVSRHILTYYRLLTGSVVLGASIA SMHYIGMSAISRVMIIYEPILFTVSIIIAIAASFVSLKIFFDLAVKKHSEHLIFYKGVSS IVMGIGISGMHYTGMLAATFHKDMAPPGSHMEVQTFHWSIFVTLIIFCIQTLLLFSSHAD RKFIKQSERIKDNEQRFQSLIVHNIDAIFILSLEGDIISSNHAGEEMISKFGFSMHDWRN YTSLKVKRLFEQVKKDKQAMNSDSDLITEKGQFHLNITLIPVEVNQELDSIYVICKDMTK QYKAEKEIHRMAHYDSLTDLPNRRHAISHLTKVLNREHSLHYNTVVFFLDLNRFKVINDA LGHNVGDQLLQFAAKRLSSVVPDNGFIARLGGDEFIIILTDANTGTGEADVLARKIIQKF KKPFKIQDHTLVTSVSIGIAISPKDGTDGLELMKKADMAMYAAKERNKSKYRYYSFSIGN KETVKLNQEMVLREAIENDRFVLHYQPQFSVKKQKMTGAEALIRLVTPDGQLRPPGEFIG VAEETGLIIDIGKWIIDEACKQARIWHDKGYDLSVAINISARQFQSKDLIPLIKDTLNKY QLPPQLLEVEVTESMTMDNLNHSKKVLSSLTELGIRISIDDFGTGHSSLSYLKDFPIHRL KIDKSFIDDIQTHPKSEQITGAIIAMGHQLSLQVIAEGVENAAQKQLLFEKGCDHLQGFF FSRPIPPEQFEQFIIEQPSQ
Source in vitro E.coli expression system
Gene Names ykoW
Protein Names Recommended name: Signaling protein ykoW
Expression Region 1-800
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable signaling protein whose physiological role is not yet known.
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

STRING: 224308.Bsubs1_010100007436

Related Products

ykoW Proteins

ykoW Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.