Recombinant Bacillus subtilis UPF0410 protein ywzA(ywzA)

Code CSB-CF516394BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O32282
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MSFLISLIVAIIIGWLGSLFVKGDMPGGIIGSMIAGLIGAWIGHGLLGTWGPHLAGFAII PAVIGAAIVVFLVSLLTRKRG
Source in vitro E.coli expression system
Gene Names ywzA
Protein Names Recommended name: UPF0410 protein ywzA
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UPF0410 family
Database Links

KEGG: bsu:BSU38180

STRING: 224308.Bsubs1_010100020611

Related Products

ywzA Proteins

ywzA Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.