Recombinant Bacillus subtilis Uncharacterized protein yddC(yddC)

Code CSB-CF308734BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P96640
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSA VTWVIKHWSEFSGWINALMEKL
Source in vitro E.coli expression system
Gene Names yddC
Protein Names Recommended name: Uncharacterized protein yddC
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Database Links

KEGG: bsu:BSU04920

STRING: 224308.Bsubs1_010100002783

Related Products

yddC Proteins

yddC Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.