Recombinant Bacillus subtilis Zinc metalloprotease rasP(rasP)

Code CSB-CF521763BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O31754
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MFVNTVIAFIIIFGTLVFFHELGHLLLAQRAGILCREFAIGFGPKIFSFKKNETVYTIRL LPVGGFVRMAGEDPEMIEVKPGYTVGLLFNKEDQVEKVIINQKEKYPDALVIEVETADLE HDMKITGYEQGKEDELSSFTVSETSFFIVDGEEVQIAPYNRQFGSKPVWQRIKAIAAGPI MNFILAYVILVMLGLIQGVPSNEPMLGQLTDNGRAAEAGLKEGDYIQSINGEKMRSWTDI VSAVKENPEKEMDVAVKRDNKTLHISVTPEAVKDENKKTIGRFGSYAPTEKGVLSAVAYG ATSTVDVTKAILTNLSKLVTGQFKLDMLSGPVGIYDMTDQVAKTGIVNLFQFAAFLSINL GIVNLLPIPALDGGRLLFLFIEAIRGKPINREKEAFVVFIGVAFLMLLMLVVTWNDIQRL FL
Source in vitro E.coli expression system
Gene Names rasP
Protein Names Recommended name: Zinc metalloprotease rasP EC= 3.4.24.- Alternative name(s): Regulating alternative sigma factor protease Regulating anti-sigma-W factor activity protease
Expression Region 1-422
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Is responsible for site-2 cleavage of the RsiW anti-sigma factor
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: bsu:BSU16560

STRING: 224308.Bsubs1_010100009126

Related Products

rasP Proteins

rasP Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.