Recombinant Bartonella quintana Type IV secretion system-coupling protein virD4(virD4)

Code CSB-CF743127BSH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6FYV9
Storage Buffer Tris-based buffer,50% glycerol
Species Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Sequence MKYTKIQLALILMPIALGALTIFLVPHLLSFMINDLKANHVYWYVRSEPLLVLMLVATVS LCYTLSQKLHLRKAITLVSAVFFGITALYFIGGEIKRLTPYVGQQGITWSYALKFMDPMV VFGVICGVVLLVIQVMISSPPTSKVKRAKKGIFGDASWMNLKEAAKIFPANGQIVVGERY RVDQDGVCNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVPTCL TYPGPIVCLDPSTEIAPMVRFARKKMGNRNVIVLDPNSLLTKNFNVLDWLLDDSVPRTQR EANIVGFSKLLLTDKKSENSSAEYFSTQAHNLLTALLAHVIFSDEYEDSERNLKTLRAIL SQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL VCGNDFSSSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGKYKKRVLFVL DEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAI KDLQTAKDISERCGQMTVEVTGTNKSRGLSLGKSSYNVNYQQRALILPHEIIQEMRQDEQ IILMQGQPPLRCGRAIYFRRKEMLAAANKNRFAPQAKKN
Source in vitro E.coli expression system
Gene Names virD4
Protein Names Recommended name: Type IV secretion system-coupling protein virD4
Expression Region 1-639
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the type IV secretion system VirB/VirD4 which could be a major virulence determinant for subversion of human endothelial cell (HEC) function.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families VirD4/TraG family
Database Links

KEGG: bqu:BQ10640

STRING: 283165.BQ10640

Related Products

virD4 Proteins

virD4 Proteins for Bartonella quintana (strain Toulouse) (Rochalimaea quintana)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.