Recombinant Biopolymer transport protein exbB(exbB)

Code CSB-CF515420NFZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O06433
Storage Buffer Tris-based buffer,50% glycerol
Species Neisseria gonorrhoeae
Sequence MNLKLVFESGDPVLIGVFVLMLLMSTVTWCLVVLRCIKLYRARKGNAAVKRHMRDTLSLN DAVEKVRAVDAPLSKLAQEALQSYRNYRRNEASELAQALPLNEYLVIQIRNSMAQIMRRF DYGMTALASIGATAPFIGLFGTVWGIYHALINIGQSGQMSIAAVAGPIGEALVATAAGLF VAIPAVLAYNFLNRGTKILTQDLDAMAHDLHVRLLNQKDS
Source in vitro E.coli expression system
Gene Names exbB
Protein Names Recommended name: Biopolymer transport protein exbB
Expression Region 1-220
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the TonB-dependent energy-dependent transport of various receptor-bound substrates. Protects ExbD from proteolytic degradation and functionally stabilizes TonB (By similarity).
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ExbB/TolQ family

Related Products

exbB Proteins

exbB Proteins for Neisseria gonorrhoeae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.