Recombinant Bovine 2-acylglycerol O-acyltransferase 1(MOGAT1)

Code CSB-CF761704BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q70VZ7
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MKVEFAPLNIPLARRLQTAAVLHWLLSFLLFAQVCLGIIVFLIIYNYWFLYLPYLTWLYF DWQTPEQGGRRSEWVRNWAIWRYFKDYFPIHLIKTWDLDPSHNYIFGFHPHGVLVVGAFG NFCTNYSAFKELFPGFTSYLHVLPYWFRCPLFREYLMSSGPVSVSKKSVCHVLSKEGGGN ISVIVLGGAEESLDAHPGKFTLFIRQRKGFVKIALTHGAYLVPVFSFGENELFKQVSNPE GSWLRNVQEKLQKIMGFALPLFHARGIFQYNFGLIPYRKPIHTVVGRPIPVRQTLNPTSE QIEELHQTYMEELRKLFEEHKGKYGIPENETLIFR
Source in vitro E.coli expression system
Gene Names MOGAT1
Protein Names Recommended name: 2-acylglycerol O-acyltransferase 1 EC= 2.3.1.22 Alternative name(s): Acyl CoA:monoacylglycerol acyltransferase 1 Short name= MGAT1 Monoacylglycerol O-acyltransferase 1
Expression Region 1-335
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Diacylglycerol acyltransferase family
Database Links

KEGG: bta:407225

STRING: 9913.ENSBTAP00000011091

UniGene: Bt.28476

Related Products

MOGAT1 Proteins

MOGAT1 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.