Recombinant Bovine ATPase family AAA domain-containing protein 3 (ATAD3)

Code CSB-CF425972BO
MSDS
Size US$6879
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ATAD3
Uniprot No.
Alternative Names
ATAD3; ATPase family AAA domain-containing protein 3
Species
Bos taurus (Bovine)
Source
in vitro E.coli expression system
Expression Region
2-586
Target Protein Sequence
SWLFGIKGSKGEGTGPPLPLPPVQPGGEGSGDGGAGDRPGPKDKWSNFDPTGLERAAKA ARELEHSRHAKEALSLAQMQEQTLQLEHQAKLKEYEAAVEQLKGDQIRVQAEERRKTLSE ETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEALRRATVEREMELR HKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTILESIRTAGTLFGEGFRAFV TDWDKVTATVAGLTLLAVGIYSAKNATSVAGRYIEARLGKPSLVRETSRITVLEALRHPI QVSRRLLSKPQDALEGVVLSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLF AKKLALHSGMDYAIMTGGDVAPMGRDGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRA TEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVSFELPQREER ERLVRMYFDKYVLKPATEGKQRLKLAQFDYGKKCSEIAQLTEGMSGREISQLAVAWQAMA YASEDGVLTEAMMDARVQDAIQQHRQKMQWLKAEGSQPPTLRTQAE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for mitochondrial network organization, mitochondrial metabolism and cell growth at organism and cellular level. May play an important role in mitochondrial protein synthesis. May also participate in mitochondrial DNA replication. May bind to mitochondrial DNA D-loops and contribute to nucleoid stability. Required for enhanced channeling of cholesterol for hormone-dependent steroidogenesis. Involved in mitochondrial-mediated antiviral innate immunity.
Gene References into Functions
  1. ATAD3A positively regulated milk protein, fat, and lactose biosynthesis, and cell proliferation by mammary epithelial cells. PMID: 29286187
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion matrix, mitochondrion nucleoid.
Protein Families
AAA ATPase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*