Recombinant Bovine Adipogenin(ADIG)

Code CSB-CF001365BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2EMW0
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MKYPLVPLVNELTFSFLVFWLCLPVALLLFLLIIWLRFLLSQDSEENDSDVCLDWEPWSK NPDEFCQEEMLHSQEEERPCC
Source in vitro E.coli expression system
Gene Names ADIG
Protein Names Recommended name: Adipogenin
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in stimulating adipocyte differentiation and development.
Subcellular Location Membrane, Single-pass membrane protein, Nucleus
Protein Families Adipogenin family
Tissue Specificity Highly expressed in subcutaneous, perirenal and mesecentric adipose tissue.
Database Links

KEGG: bta:510677

STRING: 9913.ENSBTAP00000041676

UniGene: Bt.46117

Related Products

ADIG Proteins

ADIG Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.