Recombinant Bovine Apoptosis-inducing factor 2(AIFM2)

Code CSB-CF001493BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A5PJM4
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence GSQVSMDAGAVHVVIVGGGFGGIAAASQLQALNIPFVLVDMKDSFHHNVAALRASVESGFAKKTFISYSVTFKENFRQGLVVEIDLKNQTVLLEDGQALPFSHLILATGSTGLFPGKFNQVSSQQMAIQAYEDMVTQVQRSQSIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSKMALADTELLPCVRQEVKEILLRKGVQLLLSERVSNLEALPVNERRECIKVQTDKGTEVDANLVIVCNGIKINSAAYRSAFGDRLASNGALRVNEYLQVEGYSHIYAIGDCADVREPKMAYHASLHANVAVANIVNSMKQRPLKTYKPGSLTFLLAMGRNDGVGQISGFYVGRLMVRLAKSRDLLVSTSWKTMKQSPP
Source in vitro E.coli expression system
Gene Names AIFM2
Protein Names Recommended name: Apoptosis-inducing factor 2 EC= 1.-.-.-
Expression Region 2-373
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death. Binds to DNA in a sequence-independent manner. May contribute to genotoxin-induced growth arrest (By similarity).
Subcellular Location Cytoplasm, Mitochondrion outer membrane, Membrane, Lipid-anchor
Protein Families FAD-dependent oxidoreductase family
Database Links

KEGG: bta:534217

STRING: 9913.ENSBTAP00000001550

UniGene: Bt.37372

Related Products

AIFM2 Proteins

AIFM2 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.