Recombinant Bovine DnaJ homolog subfamily C member 22(DNAJC22)

Code CSB-CF621057BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q17QW0
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MAKGLLMTYTLWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWMLPSFVAQAN RAQEQRQGSGRGTPPLSLIRFVAQMIVGMYFGLVALISLSFMASFYIVGLPLAVGLGVLL VAAVGNQTSDLKNTLGAAFLTSPIFYGRPIAILPISLAASITAQKHRRYKPSVGSETLSV RLYRLGLAYLAFTGPLVHSVLCHTAVTLSYVADTLGSFLSWFSFFPLLGRLLESVLLLPF RAWKLLVGDHGISSSYFQEWEKLYEFVHSFQDEKRQLALQVFGLSEGATNEEIHGRYREL VKTWHPDHNRYQMEEAQRRFLEIQAAYEVLRQPRKPRGSWRWEETSF
Source in vitro E.coli expression system
Gene Names DNAJC22
Protein Names Recommended name: DnaJ homolog subfamily C member 22
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function as a co-chaperone.
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: bta:515215

STRING: 9913.ENSBTAP00000055590

UniGene: Bt.13617

Related Products

DNAJC22 Proteins

DNAJC22 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.