Recombinant Bovine ER lumen protein retaining receptor 1(KDELR1)

Code CSB-CF012129BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P33946
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYN TCMKVVYIACSFTTVWMIYSKFKATYDGNHDTFRVEFLVIPTAILAFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA
Source in vitro E.coli expression system
Gene Names KDELR1
Protein Names Recommended name: ER lumen protein retaining receptor 1 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1 Short name= KDEL receptor 1
Expression Region 1-212
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the retention of luminal endoplasmic reticulum resident proteins via vesicular recycling. This receptor recognizes the C-terminal K-D-E-L motif. COPI-coated transport intermediates, either in the form of round vesicles or as tubular processes, mediate retrograde traffic of the KDEL receptor-ligand complexes. Also required for normal vesicular traffic through the Golgi (By similarity).
Subcellular Location Cytoplasmic vesicle, COPI-coated vesicle membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane
Protein Families ERD2 family
Database Links

KEGG: bta:618184

STRING: 9913.ENSBTAP00000005857

UniGene: Bt.37666

Related Products

KDELR1 Proteins

KDELR1 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.