Recombinant Bovine Hyaluronan synthase 2(HAS2)

Code CSB-CF010140BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O97711
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Bos taurus (Bovine)
Sequence MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQ SLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVI DGNSEDDLYMMDIFSEVMGRDKSATYIWKNNYHVKGPGETDESHKESSQHVTQLVLSNKS ICTMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGSQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGKIWNTLLFLLTVQLVGLIK SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSVWFTILLGGVIFTIYKESKKPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRR KKGQQYDMVLDV
Source in vitro E.coli expression system
Gene Names HAS2
Protein Names Recommended name: Hyaluronan synthase 2 EC= 2.4.1.212 Alternative name(s): Hyaluronate synthase 2 Hyaluronic acid synthase 2 Short name= HA synthase 2
Expression Region 1-552
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families NodC/HAS family
Tissue Specificity Expressed in corneal endothelial cells.
Database Links

KEGG: bta:281220

STRING: 9913.ENSBTAP00000026503

UniGene: Bt.63577

Related Products

HAS2 Proteins

HAS2 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.