Recombinant Bovine Peroxisomal membrane protein 11B(PEX11B)

Code CSB-CF621796BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q148K5
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MDAWVRFSAQSQARERLCRAAQYACSLLGHALQKHGASPELQKQIRQLEGHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGVSGGIEPGGPGGPGIPGG GLPQVALKLRLRVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGLV SSILSILTLICPWLRLKP
Source in vitro E.coli expression system
Gene Names PEX11B
Protein Names Recommended name: Peroxisomal membrane protein 11B Alternative name(s): Peroxin-11B Peroxisomal biogenesis factor 11B
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in peroxisomal proliferation. May regulate peroxisome division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane. Promotes membrane protrusion and elongation on the peroxisomal surface.
Subcellular Location Peroxisome membrane, Single-pass membrane protein
Protein Families Peroxin-11 family
Database Links

KEGG: bta:506527

STRING: 9913.ENSBTAP00000011022

UniGene: Bt.8473

Related Products

PEX11B Proteins

PEX11B Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.