Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF612669BO |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q0P5A0 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Bos taurus (Bovine) |
| Sequence | MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTIHVTRRPVLYFHVRWGFSKQAVA IVHAVLLGVVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKEEDQMHIIEHDQLS FSSITDQAAGVQEDQKQNEPFVSPQPPALADGASDH |
| Source | in vitro E.coli expression system |
| Gene Names | KCNK1 |
| Protein Names | Recommended name: Potassium channel subfamily K member 1 |
| Expression Region | 1-336 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues. Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K(+) ions at physiological potassium concentrations and at neutral pH, but becomes permeable to Na(+) at subphysiological K(+) levels and upon acidification of the extracellular medium. The homodimer has very low potassium channel activity, when expressed in heterologous systems, and can function as weakly inward rectifying potassium channel (By similarity). Channel activity is modulated by activation of serotonin receptors (By similarity). Heterodimeric channels containing KCNK1 and KCNK2 have much higher activity, and may represent the predominant form in astrocytes (By similarity). Heterodimeric channels containing KCNK1 and KCNK3 or KCNK9 have much higher activity. Heterodimeric channels formed by KCNK1 and KCNK9 may contribute to halothane-sensitive currents (By similarity). Mediates outward rectifying potassium currents in dentate gyrus granule cells and contributes to the regulation of their resting membrane potential (By similarity). Contributes to the regulation of action potential firing in dentate gyrus granule cells and down-regulates their intrinsic excitability (By similarity). In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (By similarity). Required for normal ion and water transport in the kidney (By similarity). Contributes to the regulation of the resting membrane potential of pancreatic beta cells (By similarity). The low channel activity of homodimeric KCNK1 may be due to sumoylation. The low channel activity may be due to rapid internalization from the cell membrane and retention in recycling endosomes (By similarity). |
| Subcellular Location | Cell membrane, Multi-pass membrane protein, Recycling endosome, Cell junction, synapse, Cytoplasmic vesicle, Perikaryon, Cell projection, dendrite, Cell projection, Apical cell membrane, Multi-pass membrane protein |
| Protein Families | Two pore domain potassium channel (TC 1.A.1.8) family |
| Database Links |
KEGG: bta:505563 STRING: 9913.ENSBTAP00000005929 UniGene: Bt.8363 |
KCNK1 Proteins for Bos taurus (Bovine)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP612669BO1 CSB-EP612669BO1 CSB-BP612669BO1 CSB-MP612669BO1 |
Recombinant Bovine Potassium channel subfamily K member 1(KCNK1),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Meteorin-like protein(METRNL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Vascular endothelial growth factor B(VEGFB)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Pyridoxal phosphate phosphatase(Pdxp)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Translationally-controlled tumor protein(Tpt1)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Immunity-related GTPase family M protein(IRGM)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine L-2-hydroxyglutarate dehydrogenase, mitochondrial(L2HGDH)
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human Retinal dehydrogenase 2(ALDH1A2)
Express system: Yeast
Species: Homo sapiens (Human)
