Code | CSB-CF612669BO |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | KCNK1 |
Uniprot No. | Q0P5A0 |
Species | Bos taurus (Bovine) |
Expression Region | 1-336 |
Target Protein Sequence | MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTIHVTRRPVLYFHVRWGFSKQAVA IVHAVLLGVVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKEEDQMHIIEHDQLS FSSITDQAAGVQEDQKQNEPFVSPQPPALADGASDH |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues. Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K(+) ions at physiological potassium concentrations and at neutral pH, but becomes permeable to Na(+) at subphysiological K(+) levels and upon acidification of the extracellular medium. The homodimer has very low potassium channel activity, when expressed in heterologous systems, and can function as weakly inward rectifying potassium channel (By similarity). Channel activity is modulated by activation of serotonin receptors (By similarity). Heterodimeric channels containing KCNK1 and KCNK2 have much higher activity, and may represent the predominant form in astrocytes (By similarity). Heterodimeric channels containing KCNK1 and KCNK3 or KCNK9 have much higher activity. Heterodimeric channels formed by KCNK1 and KCNK9 may contribute to halothane-sensitive currents (By similarity). Mediates outward rectifying potassium currents in dentate gyrus granule cells and contributes to the regulation of their resting membrane potential (By similarity). Contributes to the regulation of action potential firing in dentate gyrus granule cells and down-regulates their intrinsic excitability (By similarity). In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (By similarity). Required for normal ion and water transport in the kidney (By similarity). Contributes to the regulation of the resting membrane potential of pancreatic beta cells (By similarity). The low channel activity of homodimeric KCNK1 may be due to sumoylation. The low channel activity may be due to rapid internalization from the cell membrane and retention in recycling endosomes (By similarity). |
Subcellular Location | Cell membrane, Multi-pass membrane protein, Recycling endosome, Cell junction, synapse, Cytoplasmic vesicle, Perikaryon, Cell projection, dendrite, Cell projection, Apical cell membrane, Multi-pass membrane protein |
Protein Families | Two pore domain potassium channel (TC 1.A.1.8) family |
Database Links |
KEGG: bta:505563 STRING: 9913.ENSBTAP00000005929 UniGene: Bt.8363 |
Recombinant Human Small proline-rich protein 2B(SPRR2B)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Aldo-keto reductase family 1 member C3(AKR1C3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Inositol-trisphosphate 3-kinase B(ITPKB),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human SCAN domain-containing protein 1(SCAND1)
Express system: E.coli
Species: Homo sapiens (Human)