Recombinant Bovine Prostaglandin E2 receptor EP3 subtype(PTGER3)

Code CSB-CF018972BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P34979
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MKATRDHASAPFCTRFNHSDPGIWAAERAVEAPNNLTLPPEPSEDCGSVSVAFSMTMMIT GFVGNALAITLVSKSYRRREGKRKKSFLLCIGWLALTDMVGQLLTSPVVIVLYLSHQRWE QLDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALATRAPHWYSSHMKTSVTRAVLLGV WLAVLAFALLPVLGVGQYTIQWPGTWCFISTGPGGNGTNSRQNWGNVFFASAFAILGLSA LVVTFACNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIM MLKMIFNHTSVEHCKTYTENQDECNFFLIAVRLASLNQILDPWVYLLLRKILLQKFCQLL KGHSYGLDTEGGTENKDKEMKENLYISNLSRFFILLGHFTEARRGRGHIYLHTLEHQ
Source in vitro E.coli expression system
Gene Names PTGER3
Protein Names Recommended name: Prostaglandin E2 receptor EP3 subtype Short name= PGE receptor EP3 subtype Short name= PGE2 receptor EP3 subtype Alternative name(s): Prostanoid EP3 receptor
Expression Region 1-417
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for prostaglandin E2 (PGE2); the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but interact with different second messenger systems
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: bta:282330

STRING: 9913.ENSBTAP00000025607

UniGene: Bt.348

Pathway Calcium signaling pathway
cAMP signaling pathway

Related Products

PTGER3 Proteins

PTGER3 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.