Recombinant Bovine Protein CASC4(CASC4)

Code CSB-CF004536BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2VE10
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MVGFGANRRAGRLPSLVLAVLLVVIAVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDSHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQIKELRAQHEENIKKLADQFLQEQKQEAHKFESKGGNELDTDNHAVPKNIPEVAENGAGKNEEPSSHHIPHGKEQIKRGGDAGMPGIEENDLAKAEDVPVALKKPPVSFSQYESHQVISHLPTGQPLSPNMVPDSHINHNGNSRTSKQNPSNPLQRLIPGPNLENEPRIQAEVLKQATKDRAGDFHKLKQNDEERELQMDPADYGKQRFNDAL
Source in vitro E.coli expression system
Gene Names CASC4
Protein Names Recommended name: Protein CASC4 Alternative name(s): Cancer susceptibility candidate gene 4 protein homolog
Expression Region 1-380
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families GOLM1/CASC4 family
Database Links

KEGG: bta:540780

STRING: 9913.ENSBTAP00000048585

UniGene: Bt.20565

Related Products

CASC4 Proteins

CASC4 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.