Recombinant Bovine Protein delta homolog 2(DLK2)

Code CSB-CF006946BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A4FV93
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence NDCSSLCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHTGWAGKFCDKDEHICTTQSPCRNGGQCVYDGGGDYHCVCPPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLAGFMGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFTGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPGPAATADSPPGPTLAVLVPATGPIPHSAGAGLLRISVKEVVRRQEAGLGEPSLVAVVVFGAVTAALVLSTVLLTLRAWRRGFCPPGPCCYPAPHYAPARQDQECQVSMLPTGLPLPPDLPPEPGKTTAL
Source in vitro E.coli expression system
Gene Names DLK2
Protein Names Recommended name: Protein delta homolog 2 Short name= DLK-2 Alternative name(s): Epidermal growth factor-like protein 9 Short name= EGF-like protein 9
Expression Region 27-383
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Regulates adipogenesis.
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

KEGG: bta:540262

STRING: 9913.ENSBTAP00000007690

UniGene: Bt.24383

Related Products

DLK2 Proteins

DLK2 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.