Recombinant Bovine Receptor expression-enhancing protein 4(REEP4)

Code CSB-CF675855BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3ZCI8
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MVSWMICRLVVLVFGMLYPAYASYKAVKTKNIREYVRWMMYWIVFALFMAVETFTDIFIS WFPFYYEIKMAFVLWLLSPYTRGASMLYRKFVHPSLSRHEKEIDTYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGKLRSFSMQDLRTIPDGPAPTYQDPLYLEDQVPHR RPPIGYRAGGLRDSDTDNECWSDTEVVPQPPARPREKPLGRSQSLRVIKRKPLAREGTSR SLKVRTRKKTAPSDMDS
Source in vitro E.coli expression system
Gene Names REEP4
Protein Names Recommended name: Receptor expression-enhancing protein 4
Expression Region 1-257
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes (By similarity).
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families DP1 family
Database Links

KEGG: bta:519613

STRING: 9913.ENSBTAP00000012505

UniGene: Bt.49270

Related Products

REEP4 Proteins

REEP4 Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.