Recombinant Bovine herpesvirus 1.1 Envelope glycoprotein D(gD)

Code CSB-CF316790BJU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0CK29
Storage Buffer Tris-based buffer,50% glycerol
Species Bovine herpesvirus 1.1 (strain P8-2) (BoHV-1) (Infectious bovine rhinotracheitis virus)
Sequence LPTPAPRVTVYVDPPAYPMPRYNYTERWHTTGPIPSPFADGREQPVEVRYATSAAACDML ALIADPQVGRTLWEAVRRHARAYNATVIWYKIESGCARPLYYMEYTECEPRKHFGYCRYR TPPFWDSFLAGFAYPTDDELGLIMAAPARLVEGQYRRALYIDGTVAYTDFMVSLPAGDCW FSKLGAARGYTFGACFPARDYEQKKVLRLTYLTQYYPQEAHKAIVDYWFMRHGGVVPPYF EESKGYEPPPAADGGSPAPPGDDEAREDEGETEDGAAGREGNGGPPGPEGDGESQTPEAN GGAEGEPKPGPSPDADRPEGWPSLEAITHPPPAPATPAAPDAVPVSVGIGIAAAAIACVA AAAAGAYFVYTRRRGAGPLPRKPKKLPAFGNVNYSALPG
Source in vitro E.coli expression system
Gene Names gD
Protein Names Recommended name: Envelope glycoprotein D Short name= gD Alternative name(s): Glycoprotein IV
Expression Region 19-417
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Envelope glycoprotein that binds to host cell entry receptors. May trigger fusion with host membrane, by recruiting the fusion machinery composed of gB and gH/gL (By similarity).
Subcellular Location Virion membrane, Single-pass type I membrane protein
Protein Families Herpesviridae glycoprotein D family
Database Links

KEGG: vg:1487406

Related Products

gD Proteins

gD Proteins for Bovine herpesvirus 1.1 (strain P8-2) (BoHV-1) (Infectious bovine rhinotracheitis virus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.