Tel : 301-363-4651
All
  • All
  • Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Raw Material For IVD Kit

EGFR｜BCMA｜CD44｜EPHA3｜TROP2｜EFNA5｜PD-L1｜KLRK1｜CD22｜CD46｜CD276


Recombinant Bovine respiratory syncytial virus Major surface glycoprotein G(G)

Code CSB-CF300828BKV
Size Pls inquire other sizes
Source in vitro E.coli expression system

Product Details

Target Names G
Uniprot No. P69350
Species Bovine respiratory syncytial virus (strain Rb94) (BRS)
Expression Region 1-257
Target Protein Sequence MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITALI YISVGNAKAKPTSKPTIQQTQRPQNHTSPLFTEHNYKSTHTSIQSTTLSQLLNIDTTRGT TYSHPTDETQNRKIKSQSTLPATRQPPINPSGSNPPENHQDHNNSQTLPYVPCSTCEGNL ACSSLCQIGLERAPSRAPTITLKKAPKPKTTKKPTKTTIHHRTSPEAKLQPKNNTAAPQQ GILSSPEHHTNQSTTQI
Protein Length full length protein
Tag Info The following tags are available.
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs		 Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.
Still Have Questions? Start a Chat

Related Products

G Proteins

Target Data

Function Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (By similarity).
Subcellular Location Virion membrane, Host cell surface, SUBCELLULAR LOCATION: Isoform Secreted glycoprotein G: Secreted
Protein Families Pneumoviruses glycoprotein G family

Most popular with customers

Promotions
Contact Us

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
The Overview of Gastric Cancer SWISS-PROT: When and How to Use It Information You Must Know about KCNN4 The True Face of Tumor Suppressor Gene p53 Two Types of Macrophages: M1 and M2 Macrophages EGFR and Its Application in Cancer Therapy Dual Role of TNFRSF14 in Immunology Learn to Distinguish Moles from Melanomas CD31- A Complex Function Molecule CD14-- A Membrane Receptor for Bacterial Lipopolysaccharides These Surface Markers Help You Identify Lymphocytes How Do You Get Exosomes? Cell Differentiation Determines the Fate of Cells CAR-T Cell Therapy- An Useful Treatment To Cancer CD19-The Most Popular Target with CAR T-Cell Therapy A Resume for Transmembrane Proteins Ovarian Cancer -- The Silent Killer G protein-Coupled Receptor - Targets for Drug Therapy Differentiation of Th17 Cells Tag Antibodies, Your Good Partner in Protein Research How to Choose the Loading Control Antibodies? Knowledge about Transthyretin Homeobox Transcription Factor- NANOG How to Inquire and Utilize the Signal Pathway on KEGG Costimulatory/Coinhibitory: Is B7-H3 An Enemy or A Friend? The Overview of Fc Receptors- Classification, Related Signaling Pathways and Application Effects of FSHR on Fertility and Tumors The Overview of Recombinant Antibody Chemokine Receptors – One Kind of Powerful Seven Transmembrane Spanning G Protein-coupled Receptor How to Choose the Right Secondary Antibody? A transport machine -- ATP-binding cassette Glial Fibrillary Acidic Protein - Astrocyte Specific Marker Oct4 -- The Gatekeeper of Pluripotency of Embryonic Stem Cells Understanding Hepatitis, Fighting Hepatitis Biological Activity of Proteins Stem Cell-What a Miraculous Resource in Human Body IL-6-Do You Really Know That? Growth Hormone - Not Only Promotes Height Increase The Rare Disease-Huntington's Disease One World, One Hope——What Can We Do about AIDS? LPS/TLR4 Signal Transduction Pathway Toll-like Receptors--The Eye of Innate Immunity Ice Bucket Challenge – Pay your attention to amyotrophic lateral sclerosis CD46, A Complement Regulator Human Leukocyte Antigen: Distinguish between Friend and Foe A "trembling" Parkinson's Disease What Are Immune Checkpoints? What Is Immune Checkpoint Therapy? What Are Immune Checkpoint Inhibitors? What Are Immune Checkpoint Proteins? Focus on Emerging Therapeutic Targets BCMA What Are Immune Checkpoint Pathways? Tumor Necrosis Factor Receptor Superfamily and Apoptosis The Overview of Hippo Signaling Pathway What You Should Know The Common Sense of Neurodegeneration A Switch that Controls the Entry and Exit of Ions CD44- A Powerful Bridge Between Cells Tools You Need For Fundamental Research How do Th1 and Th2 Cells Differentiate? CD22- What A Powerful Co-receptor of B Cell Receptor What Powerful Model Organism Databases TCGA Database- A Good Partner of Researchers What a Powerful Artifact of DNA Compression - Histone Epigenetic Histone Modifications Pathway How Does Histone Modification Affect Gene Expression? How to Measure Histone Modification? Histone modification and Cancer Four Common Histone Modifications About Thyroid Tumor, This Information You Must Know! What A Paradoxical TNF Signaling Pathway-Based on Different Receptors Don't Let Hepatocellular Carcinoma What Are the Effects of Abnormalities in the ALK Gene These Tumor Databases You Have To Know CD146, A Powerful Tumor Marker Introduction of Hepatocellular Carcinoma Related Signaling Pathways Mesothelin: A Rising Star of Cancer Immunotherapy PD-1-- An Important Immune Checkpoint Does TNF Superfamily Inhibit Cancer or Promote Its Development? TROP2-An Important Target for Cancer Treatment MOA1-A Potential Cancer Therapy Target CD Antigens - From Leucocytes Surface Markers to Diagnostic Markers for Cancer Latest Changes in Journal Impact Factor Surface Markers of Natural Killer Cells What Is an Antibody? Applications of recombinant proteins How to choose a suitable expression vector? How to express a protein with bioactivity? 11 tips for choosing your right ELISA kit The Overview of Chemokine General Information of Different Tags CUSABIO's Five Expression Systems The Nature of Detergent and Its Application in Membrane Proteins The Overview of Colony Stimulating Factors Do You Really Know Neurons and Glia Cells in Nerve System? Apoptosis mediated by mitochondria Apoptosis mediated by endoplasmic reticulum Apoptosis mediated by death receptor Aesthetic Appreciation of Apoptosis Signal Pathway The Application of Nanodiscs in Membrane Proteins PD-1/PD-L1, What a Powerful Immune Checkpoint EphA3-A Regulator of Cell Adhesion and Migration The Overview of Growth Factor Tumor Necrosis Factor (TNF) The Overview of Interferon Tumor markers The Overview of Interleukin The Overview of Organelles The Overview of Autophagy Four Types of ELISA How to Choose an Antibody for Scientific Research? Production of Recombinant Protein The Overview of Phage Display：Protocol, Classification, Application and FAQs Crosstalk Between Autophagy and Apoptosis The Overview of Breast Cancer: Related Signaling Pathways, Therapeutic Targets The overview of Wnt signaling pathway The overview of TGF-β signaling pathway The Encyclopedia of Common Virus PI3K-Akt Signaling Pathway and Cancer Double-Edged Sword: TGF-β Do You Really Know TGF-β Superfamily? What You Have to Know about Exosomes CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
+ Show More
- Show Less

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.