Code | CSB-CF300828BKV |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | G |
Uniprot No. | P69350 |
Species | Bovine respiratory syncytial virus (strain Rb94) (BRS) |
Expression Region | 1-257 |
Target Protein Sequence | MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITALI YISVGNAKAKPTSKPTIQQTQRPQNHTSPLFTEHNYKSTHTSIQSTTLSQLLNIDTTRGT TYSHPTDETQNRKIKSQSTLPATRQPPINPSGSNPPENHQDHNNSQTLPYVPCSTCEGNL ACSSLCQIGLERAPSRAPTITLKKAPKPKTTKKPTKTTIHHRTSPEAKLQPKNNTAAPQQ GILSSPEHHTNQSTTQI |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (By similarity). |
Subcellular Location | Virion membrane, Host cell surface, SUBCELLULAR LOCATION: Isoform Secreted glycoprotein G: Secreted |
Protein Families | Pneumoviruses glycoprotein G family |
Recombinant Bovine Glycolipid transfer protein(GLTP)
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Thyroid hormone receptor beta(THRB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Matrix metalloproteinase-9(MMP9) ,partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Cyclic AMP-dependent transcription factor ATF-7(ATF7)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Sheep Tumor necrosis factor(TNF),partial,partial
Express system: Yeast
Species: Ovis aries (Sheep)
Recombinant Human Tyrosine-protein kinase JAK1(JAK1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Casein kinase I isoform epsilon(CSNK1E)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide