Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF300828BKV |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P69350 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Bovine respiratory syncytial virus (strain Rb94) (BRS) |
| Sequence | MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALTTLAMITLTSLVITALI YISVGNAKAKPTSKPTIQQTQRPQNHTSPLFTEHNYKSTHTSIQSTTLSQLLNIDTTRGT TYSHPTDETQNRKIKSQSTLPATRQPPINPSGSNPPENHQDHNNSQTLPYVPCSTCEGNL ACSSLCQIGLERAPSRAPTITLKKAPKPKTTKKPTKTTIHHRTSPEAKLQPKNNTAAPQQ GILSSPEHHTNQSTTQI |
| Source | in vitro E.coli expression system |
| Gene Names | G |
| Protein Names | Recommended name: Major surface glycoprotein G Alternative name(s): Attachment glycoprotein G Membrane-bound glycoprotein Short name= mG |
| Expression Region | 1-257 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities (By similarity). |
| Subcellular Location | Virion membrane, Host cell surface, SUBCELLULAR LOCATION: Isoform Secreted glycoprotein G: Secreted |
| Protein Families | Pneumoviruses glycoprotein G family |
G Proteins for Bovine respiratory syncytial virus (strain Rb94) (BRS)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP300828BKV1 CSB-EP300828BKV1 CSB-BP300828BKV1 CSB-MP300828BKV1 |
Recombinant Bovine respiratory syncytial virus Major surface glycoprotein G(G) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Replication factor C subunit 1(RFC1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Bovine Muellerian-inhibiting factor(AMH),Yeast
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Telomerase reverse transcriptase(TERT),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Pig Epididymal secretory glutathione peroxidase(GPX5)
Express system: E.coli
Species: Sus scrofa (Pig)
Recombinant Atlantic salmon Vertebrate ancient opsin，Partial
Express system: E.coli
Species: Salmo salar (Atlantic salmon)
