Recombinant Bovine viral diarrhea virus Genome polyprotein

Code CSB-CF842615BFAC
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Uniprot No.
Alternative Names
Genome polyprotein
Species
Bovine viral diarrhea virus (strain CP7) (BVDV) (Mucosal disease virus)
Expression Region
3189-3907
Target Protein Sequence
SSWFLQATNKQMSLTPLFEELLLRCPPKIKSNKGHMASAYQLAQGNWEPLDCGVHLGTIP ARRVKIHPYEAYLKLKDLLEEEEKKPKCRDTVIREHNKWILKKVRHQGNLNTKKILNPGK LSEQLDREGHKRNIYNNQIGTIMTEAGSRLEKLPVVRAQTDTKSFHEAIRDKIDKNENQQ SPGLHDKLLEIFHTIAQPSLRHTYSDVTWEQLEAGVNRKGAAGFLEKKNVGEVLDSEKHL VEQLIRDLKTGRKIRYYETAIPKNEKRDVSDDWQSGDLVDEKKPRVIQYPEAKTRLAITK VMYNWVKQQPVVIPGYEGKTPLFNIFNKVRKEWDLFNEPVAVSFDTKAWDTQVTSRDLRL IGEIQKYYYRKEWHKFIDTITDHMVEVPVITADGEVYIRNGQRGSGQPDTSAGNSMLNVL TMMYAFCESTGVPYKSFNRVARIHVCGDDGFLITEKGLGLKFANNGMQILHEAGKPQKIT EGERMKVAYRFEDIEFCSHTPVPVRWSDNTSSYMAGRDTAVILSKMATRLDSSGERGTIA YEKAVAFSFLLMYSWNPLVRRICLLVLSQQPETTPSTQTTYYYKGDPIGAYKDVIGKNLC ELKRTGFEKLANLNLSLSTLGIWSKHTSKRIIQDCVTIGKEEGNWLVNADRLISSKTGHL YIPDKGYTLQGKHYEQLQLQARTSPVTGVGTERYKLGPIVNLLLRRLRVLLMAAVGASS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Leader cysteine autoprotease that cleaves itself from the nascent polyprotein during translation of the viral mRNA. Once released, plays a role in the inhibition of host innate immune response by interacting with host IRF3 and inducing its proteasomal degradation.; Packages viral RNA to form a viral nucleocapsid and thereby protects viral RNA. Plays also a role in transcription regulation. Protects the incoming virus against IFN-induced effectors.; Initial binding to target cell probably involves interaction of E(rns) with glycosaminoglycans.; E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.; E1 and/or E2 are probably responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.; Plays an essential role in the virus replication cycle by acting as a viroporin. Forms ion conductive pores, which alters the cell permeability allowing the transport of ions and other small molecules. Forms a leader sequence to properly orient NS2 in the membrane.; Uncleaved NS2-3 is required for production of infectious virus.; Plays a role in the regulation of viral RNA replication.; Multifunctional protein that contains an N-terminal protease and a C-terminal helicase, playing essential roles in viral polyprotein processing and viral genome replication. The chymotrypsin-like serine protease activity utilizes NS4A as an essential cofactor and catalyzes the cleavage of the polyprotein leading to the release of NS4A, NS4B, NS5A, and NS5B. Interacts with NS5B to enhance RNA-dependent RNA polymerase activity.; Acts as a cofactor for the NS3 protease activity.; Induces a specific membrane alteration that serves as a scaffold for the virus replication complex.; Replicates the viral (+) and (-) genome.
Subcellular Location
[Capsid protein C]: Virion.; [E(rns) glycoprotein]: Host membrane; Peripheral membrane protein. Virion membrane; Peripheral membrane protein.; [Envelope glycoprotein E2]: Host cell surface. Virion membrane.; [Cysteine protease NS2]: Host membrane; Multi-pass membrane protein.; [Serine protease NS3]: Host cytoplasm.; [Non-structural protein 4B]: Host cytoplasm.; [Non-structural protein 5A]: Host cytoplasm.
Protein Families
Pestivirus polyprotein family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1