Recombinant Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic(LPAT1)

Code CSB-CF867963BWD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9LLY4
Storage Buffer Tris-based buffer,50% glycerol
Species Brassica napus (Rape)
Sequence SDLSGAATPESTYPEPEIKLSSRLRGICFCLVAGISAIVLIVLMIIGHPFVLLFDRYRRK FHHFIAKLWASISIYPFYKTDIQGLENLPSSDTPCVYVSNHQSFLDIYTLLSLGQSYKFI SKTGIFVIPVIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELVKKGASVFFFPEGTRSKDG RLGPFKKGAFTIAAKTGVPVVPITLMGTGKIMPTGSEGILNHGDVRVIIHKPIYGSKADV LCEEARNKIAESMNLLS
Source in vitro E.coli expression system
Gene Names LPAT1
Protein Names Recommended name: 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic EC= 2.3.1.51
Expression Region 88-344
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating acyl moiety at the 2 position. Has preference for C-16-CoA substrates compared to C-18-CoA substrates.
Subcellular Location Plastid, chloroplast membrane, Multi-pass membrane protein
Protein Families 1-acyl-sn-glycerol-3-phosphate acyltransferase family
Tissue Specificity Ubiquitously expressed.
Database Links

KEGG: bna:106441094

UniGene: Bna.2206

Related Products

LPAT1 Proteins

LPAT1 Proteins for Brassica napus (Rape)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.