Recombinant Brassica napus Oleosin-B3(OlnB3)

Code CSB-CF674835BWD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q42626
Storage Buffer Tris-based buffer,50% glycerol
Species Brassica napus (Rape)
Sequence LGIPESIKPSNVIPESIKPSNIIPESIKPSNIIPVSIKPSNIKDKIKDTIGKVKNKIKAK QEEKSKGKSEDSSKGKGKSKGEDTTTDEDKHGKGESKHGKGESKHGKGESTHGKGGKHGS EGSSMDEGKHGGKHGSGGSPMGGGKHGSGGKHESGGSPMGGGKHGSGGKHESGGASMGGG KHESVGKHGSGGKHESGGSPMGGGKHGSGGKHESGGASMGGGKHGSGGRHEGGGSAMGGG KHGSGGKHGSEGKHGGEGSSMGKNSLSKNKKEFHYRGQAMDASSTSESSDGSSSDGSSSD GSSSDGSSHGSGGKHI
Source in vitro E.coli expression system
Gene Names OlnB3
Protein Names Recommended name: Oleosin-B3 Cleaved into the following chain: 1. Pollen coat protein B3
Expression Region 109-424
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Many of the major pollen coat proteins are derived from endoproteolytic cleavage of oleosin-like proteins.
Subcellular Location Lipid droplet, Membrane, Multi-pass membrane protein
Protein Families Oleosin family
Tissue Specificity The full-length protein is found in the tapetal lipid bodies of immature anthers, the proteolytically cleaved C-terminal product is found on the coats of pollen grains. No expression is detected in other flower organs, siliques or seedlings.
Database Links

KEGG: bna:106449581

UniGene: Bna.1010

Related Products

OlnB3 Proteins

OlnB3 Proteins for Brassica napus (Rape)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.