Recombinant Brucella abortus Type IV secretion system protein virB6(virB6)

Code CSB-CF652909BMN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q2YJ76
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Brucella abortus (strain 2308)
Sequence MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGP FSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDN SLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIA ILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVALLSAVLSISSAIFSRMVAAINLA SATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISAATISLGSLAVNTATSGGGAM TSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD
Source in vitro E.coli expression system
Gene Names virB6
Protein Names Recommended name: Type IV secretion system protein virB6
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The virB operon is essential for intracellular survival and is not involved in the invasion process. Constitutes a major determinant of virulence in mice.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families TrbL/VirB6 family
Database Links

KEGG: bmf:BAB2_0063

Related Products

virB6 Proteins

virB6 Proteins for Brucella abortus (strain 2308)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.