Recombinant Brucella suis biovar 1 Type IV secretion system protein virB6(virB6)

Code CSB-CF870897BMQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9RPX9
Storage Buffer Tris-based buffer,50% glycerol
Species Brucella suis biovar 1 (strain 1330)
Sequence MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGP FSQLVISCIKFMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDN SLGKGWNIAAMLFEKGDNRGLTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIA ILLGIGPLFILALGWAPTRGFFDRWFGAIVTSILQVALLSAVLSISSAIFSRMVAAINLA SATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISAATISLGSLAVNTATSGGGAM TSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD
Source in vitro E.coli expression system
Gene Names virB6
Protein Names Recommended name: Type IV secretion system protein virB6
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The VirB system could be required for the establishment of the replication niche in the host.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families TrbL/VirB6 family
Database Links

KEGG: bms:BRA0064

Related Products

virB6 Proteins

virB6 Proteins for Brucella suis biovar 1 (strain 1330)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.