Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Probable protease sohB(sohB)

Code CSB-CF349856BWZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P57370
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Sequence MNLLLNYELFLAKIITFIIISISILILFYTIIKRKKNIQSKIKITLLQDNYKNVKNKILL STMKNVEKKIWFKKQKEKNKKELLLKNNKKKLFVLDFKGDVYANEVVGLREEISAILLVA NKHDEVLLRLESSGGVIHGYGLAASQLNRLRQKGIRLIVSVDKIAASGGYMMACVADYIV SAPFAIIGSIGVVGQIPNFNKLLKKCNIDFELHTAGDYKRTLTMFGNNTESTRKKFCDEL NTTHKLFKSFIKEMRPSLDIEDVSNGEHWFGTIALEKKLVDQIGTSDDILISKMEEYTLL RIQYIYRKKILERFTASVTHNLSETLLKIFFYKNYL
Source in vitro E.coli expression system
Gene Names sohB
Protein Names Recommended name: Probable protease sohB EC= 3.4.21.-
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Possible protease.
Subcellular Location Cell membrane, Single-pass membrane protein
Protein Families Peptidase S49 family
Database Links

KEGG: buc:BU283

STRING: 107806.BU283

Related Products

sohB Proteins

sohB Proteins for Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.