Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Multidrug resistance-like ATP-binding protein MdlB(mdlB)

Code CSB-CF806635BMZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q89A96
Storage Buffer Tris-based buffer,50% glycerol
Species Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Sequence MNNVIDFWPTLKRLLYYGTNVKKYLILGFTLLLFSSIFEVLNPILISCFIKHYFINNTVN YSLKIITYYLILQILAAILNYHQNIIFNKISLTVIQKLRYDVMSSTLQLPIKMFDQRPIG QFISRITNDTETIKELYDTVIKSLFQNIILILITLITMFILEWRMACIASIIFPIALIIM LLYQYFSKPILRKIKVYIANIYNIFNEIINGIDVIQQFHQEQKFRKSIKKISISHYYFRM KILKLDSFLLRPLLNFCSTLILCGLILIFGIYPIGFFEIGTLYAFITYLNRLNEPLITIT SQQSIFQQAIVAGERIFEIIHTPKQQYGDDSLHFREGNIKVKNLYFSYTNNNVYVLKNIN IFIPSKQFIAFVGRTGSGKSTLSKLLIGHYPATLGKICLDERNIQTFTHNVLKKNISIVQ QDPIILNDTILENITLGRNISTKKVLKILKTIKLIQFVNSLPKGLKTLLGENGNILSIGQ KQLLSIARTLISCPKILILDEATSNVDLDTENNIKKILSSVKHLTTIIAITHRLSTIKHA DNIFVFNNGEIVESGTHYNLIRKKSYYKNMYYSQAIKN
Source in vitro E.coli expression system
Gene Names mdlB
Protein Names Recommended name: Multidrug resistance-like ATP-binding protein MdlB EC= 3.6.3.44
Expression Region 1-578
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, Drug exporter-2 (TC 3.A.1.117) family
Database Links

KEGG: bab:bbp_424

STRING: 224915.bbp424

Related Products

mdlB Proteins

mdlB Proteins for Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.