Recombinant Buchnera aphidicola subsp. Schizaphis graminum Multidrug resistance-like ATP-binding protein MdlA(mdlA)

Code CSB-CF818374BXE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8K985
Storage Buffer Tris-based buffer,50% glycerol
Species Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Sequence MRLFNQLKWYFIKEWKRYLGSIILLIIIAFLQLLPPKIIGILIDLIIKEKMSGFEILPWI SIILLIAIIVYILRYLWRILLFGASYQLATELRVKFYSYLSKQSEIFFLKNRTGDLIARA TNDVDRVVFAAGEGVLTLVDSSVMGISVLIVMITQISWLLTIISLIPMPIMAILIKKYGK KLHDTFRNAQSAFSLLNNQTQEILTSIRMIRAFGLEKNQLKKFNNIVNDTGKKNMEVAEI DARFDPVIYLSVAFSNLLAITAGGWLVWNNTITIGKLTSFIMYLGLMIWPMLALAWMFNI VERGSAAWDRIHSIINQNLYIEDGKKTIINMNGKLNINIDMFFYPKNKKPSLKNIYLSLN PGKTLGICGPTGAGKSTLLKLIQRQFKIHKGEILYNSSSLLELKIDYWRSKIGVVNQTSF LFSDSISNNISLGKPKASQKEIEKAAKLADIHKDIVCLPQGYNTQVGERGVMLSGGQKQR IAIARALLLNTEILILDDALSAVDGKTENNILKNLKKWKDKGYSLIIVAHRLSALIHADE IIVIKEGTIIQRGNHEKLIKEKNWYKSMYDHQKIQTEIENF
Source in vitro E.coli expression system
Gene Names mdlA
Protein Names Recommended name: Multidrug resistance-like ATP-binding protein MdlA EC= 3.6.3.44
Expression Region 1-581
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, Drug exporter-2 (TC 3.A.1.117) family
Database Links

KEGG: bas:BUsg_464

STRING: 198804.BUsg464

Related Products

mdlA Proteins

mdlA Proteins for Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.