Recombinant Burkholderia cenocepacia Bifunctional protein glk(glk)

Code CSB-CF619455BAAG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1BYA7
Storage Buffer Tris-based buffer,50% glycerol
Species Burkholderia cenocepacia (strain AU 1054)
Sequence MSTGAQSKAVVAGQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTITDAIR KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA MALPGLTDAQRVQVGGGARRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRVAATVDTVEIVERAHA GDALALETVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG RFTHYLENIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDILAVGVAIRRAS TNGELPEAVAQAKARASDDETADVLDWLSHGASPAAKDVARD
Source in vitro E.coli expression system
Gene Names glk
Protein Names Recommended name: Bifunctional protein glk Including the following 2 domains: Glucokinase EC= 2.7.1.2 Alternative name(s): Glucose kinase Putative HTH-type transcriptional regulator
Expression Region 1-642
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families Bacterial glucokinase family
Database Links

KEGG: bcn:Bcen_0486

Related Products

glk Proteins

glk Proteins for Burkholderia cenocepacia (strain AU 1054)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.