Recombinant CDP-diacylglycerol pyrophosphatase(cdh)

Code CSB-CF855987YAS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8ZA34
Storage Buffer Tris-based buffer,50% glycerol
Species Yersinia pestis
Sequence MSRSIKWRRYLLTLLILIILAAGLIYKLRFSNADALWKIISQQCIPHMTTEDDPRPCAEV NIPAGFAVLKDRNGPLQYLLIPTVPISGIESPQLLTATSPNYFADAWQARYFMAEKYGAP IDDTDISLAINSQYGRTQDQLHIHISCLKPQVKTALAAHSADFQQQWQPLPGGLLGHDYW VRRITATELQQPGPFHLLADEMPGAKEQMGRYGLAITALPSGDFLLLANKASLITQDRAS AEELQDHTCQVLPHLPVQ
Source in vitro E.coli expression system
Gene Names cdh
Protein Names Recommended name: CDP-diacylglycerol pyrophosphatase EC= 3.6.1.26 Alternative name(s): CDP-diacylglycerol phosphatidylhydrolase CDP-diglyceride hydrolase
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families Cdh family
Database Links

KEGG: ype:YPO3986

STRING: 187410.y3843

Related Products

cdh Proteins

cdh Proteins for Yersinia pestis

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.