Recombinant Candida albicans pH-response regulator protein palH/RIM21(RIM21)

Code CSB-CF688446CZD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q59YK4
Storage Buffer Tris-based buffer,50% glycerol
Species Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Sequence MYWKNAWWVGTVYSSCEPIELPEGMLISKQYETYPITTVSKAIYKQMCYRNCIPVLNTNV GFVIDTFAKPLPIVSQSWREFTKDSLRGSFAYSVVSIIYAIAVSAVIIWFLTIFVLTNYT IKPSWLLKTSTILSTVYILVVVIKSILILHGQQRDGYLHGAKLLSELNDYNPIQIIDLIV VLLLQINQVQIIMRIFQRQKDKRMALLIGIVATLASQVIWAIAQFYTPADANEASDILPA FIYLVRIAMALCYAAIITVFFISKIQIILANKKIWLLTLLTFILIYSPVAFFVADVSNAF VYELSEIFSVVNYVIGVVIPWEWCNKFNLIMKAKEKEGVLGRRFYEDELYELDRFELFVE EQMPEDEDNGDTHSDSPGNELNGGAHHNSQEQSDRLIGSNSPTNKPHNGNNTDPTSRFRQ LLTNTKDAFLTLTDNIIAAGFAIPRSVSVSTQSLTGRYRNNSTARTEYTKEVVPDFSPEM FLQPEGSSHITETLSEQNAAPSTTNSNHRRRNVYVYSRKEVILDVSSDE
Source in vitro E.coli expression system
Gene Names RIM21
Protein Names Recommended name: pH-response regulator protein palH/RIM21
Expression Region 1-529
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PalH/RIM21 family
Database Links

KEGG: cal:CAALFM_C501950CA

Related Products

RIM21 Proteins

RIM21 Proteins for Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.