Recombinant Candida glabrata pH-response regulator protein palH/RIM21(RIM21)

Code CSB-CF739562CZI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6FJT9
Storage Buffer Tris-based buffer,50% glycerol
Species Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Sequence MAVSIYDSLRTPGPKHYKYKICDGIDLGDGLVIDPLNLDSLVVYAKNVKWSSFCDYGVPL YLAADTMDTPYEYPPIIMNDWRWFIFNDHYFGKYWGYGLYTILMVYSTIFVITVALTVLS FLTVNKGPYKITSLLLKLSSVLASTSIIYFLTSALSTISRQQEHYGVANGNVFGTLLNSN LVIATLNLLSMFFYKLCQVSIVARLFERKLEWRIVVFVGGIMSIVSFIISAIVSYTDRVG IRNDNLVTLSPFGLLFDIALETCFAFIIVTNVWGTRKTWVSHLQMWYLALLTIAIVLLSP AMFLADVGTGLLSAYAATVSPLLYTMSTFVAWEWLERIHILKKAAQVKSLLGQKIYEDEQ EGYNFAYYSVNNESNLDTNSDSHISLYNDMFRNSEQFSNVGSNLSSKESSSLPAQMNSTG ISFPTAVNQVEFQKRKSFLDHLTNFTYSRPYKIYKKSKSIIQLRKRNSETVKNERSNEEL SIEKVRRRLGLTNERREYVYNTKDIVFASDDDTESECESNNILNESIDSHFPENGAGSV
Source in vitro E.coli expression system
Gene Names RIM21
Protein Names Recommended name: pH-response regulator protein palH/RIM21
Expression Region 1-539
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the proteolytic cleavage of the transcription factor RIM101 in response to alkaline ambient pH.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families PalH/RIM21 family
Database Links

KEGG: cgr:CAGL0M03663g

STRING: 284593.XP_449505.1

Related Products

RIM21 Proteins

RIM21 Proteins for Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.