Recombinant Ceratitis capitata Protein white(W)

Code CSB-CF613749DRF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q17320
Storage Buffer Tris-based buffer,50% glycerol
Species Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)
Sequence MGQEDQEVLIRGGKATSTSAESLNNNNEQPYEQSSINQGFCKNYGTLSPPSPALTADNLT YSWYNLDVFGAVHQPGSSWKQLVNRVKGVFCNERHIPAPRKHLLKNDSGVAYPGELLAVM GSSGAGKTTLLNASAFRSSKGVQISPSTIRMLNGHPVDAKEMQARCAYVQQDDLFIGSLT AREHLIFQAMVRMPRHMTQKQKVQRVDQVIQDLSLGKCQNTLIGVPGRVKGLSGGERKRL AFASEALTDPPLLICDEPTSGLDSFMAHSVVQVLKKLSQKGKTVILTIHQPSSELFELFD KILLMAEGRVAFLGTPGEAVDFFSYIGATCPTNYTPADFYVQVLAVVPGREVESRDRVAK ICDNFAVGKVSREMEQNFQKLVKSNGFGKEDENEYTYKASWFMQFRAVLWRSWLSVLKEP LLVKVRLLQTTMVAVLIGLIFLGQQLTQVGVMNINGAIFLFLTNMTFQNSFATITVFTTE LPVFMRETRSRLYRCDTYFLGKTIAELPLFLVVPFLFTAIAYPLIGLRPGVDHFFTALAL VTLVANVSTSFGYLISCACSSTSMALSVGPPVIIPFLLFGGFFLNSGSVPVYFKWLSYLS WFRYANEGLLINQWADVKPGEITCTLSNTTCPSSGEVILETLNFSASDLPFDFIGLALLI VGFRISAYIALTMRARRKE
Source in vitro E.coli expression system
Gene Names W
Protein Names Recommended name: Protein white
Expression Region 1-679
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be part of a membrane-spanning permease system necessary for the transport of pigment precursors into pigment cells responsible for eye color.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily

Related Products

W Proteins

W Proteins for Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.