Recombinant Chara vulgaris ATP synthase subunit c, chloroplastic(atpH)

Code CSB-CF624351CBAK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q1ACN0
Storage Buffer Tris-based buffer,50% glycerol
Species Chara vulgaris (Common stonewort)
Sequence MNPLISAASVIAAGLAVGLSSIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV
Source in vitro E.coli expression system
Gene Names atpH
Protein Names Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein
Expression Region 1-81
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Subcellular Location Plastid, chloroplast thylakoid membrane, Multi-pass membrane protein
Protein Families ATPase C chain family

Related Products

atpH Proteins

atpH Proteins for Chara vulgaris (Common stonewort)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.