Recombinant Chicken Abhydrolase domain-containing protein 13(ABHD13)

Code CSB-CF730498CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5ZJL8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Gallus gallus (Chicken)
Sequence MEKSRMLWTFVERWLLALASWSWGLCRISLLPLIVTFHLYGGIILLLLIFVSIAGILYKF QDMLLYFPEQPSSSRLYVPMPTGIPHENIFIKTKDGVLLNLILLRYTGDNAAYSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSEGEASEEGLYIDSEAVLDYVMTRS DLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPL WCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPARTKRLAIFPDGTHND TWQCQGYFTALEQFIKEVIKSHSSEEMAKTSSNVTII
Source in vitro E.coli expression system
Gene Names ABHD13
Protein Names Recommended name: Abhydrolase domain-containing protein 13 EC= 3.-.-.-
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Serine esterase family
Database Links

KEGG: gga:418763

STRING: 9031.ENSGALP00000027178

UniGene: Gga.14570

Related Products

ABHD13 Proteins

ABHD13 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.