Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)

Code CSB-CF007694CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. E1C1L6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Gallus gallus (Chicken)
Sequence MTSSRLPVLLALVFSSLSPVLSHSNREMWFQDLFPPNTCPINAKTKTFYGIMFDAGSTGTRIHIYTFVQKSPEILPELEGEIFESVKPGLSAYADQPEKGAESVKRLLDMAIDAVPPHLWKKTPVVLKATAGLRLLSEEKAQALLSEVKEVFEESPFLVPEDSVSIMDGSYEGILAWITVNFLTGQLSGQNQHTVGTLDLGGASTQITFLPRFEETLKESPTDFLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALNTEVADRQMFRSSCLPKQLEAEWHFGGVKYRYGGNKEGETGFKPCYLEVLKVVKGKLHQPDEIRGSSFYAFSYYYDRAADTNLIDYEQGGVLEVRDFERKAKEVCDNMERFSSASPFLCMDLTYITALLKEGFGFRDNTLLQLTKKVNNIETSWTLGATFHLLQSLGITY
Source in vitro E.coli expression system
Gene Names ENTPD5
Protein Names Recommended name: Ectonucleoside triphosphate diphosphohydrolase 5 Short name= NTPDase 5 EC= 3.6.1.6 Alternative name(s): Guanosine-diphosphatase ENTPD5 Short name= GDPase ENTPD5 EC= 3.6.1.42 Uridine-diphosphatase ENTPD5 Short name= U
Expression Region 1-428
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. The nucleotide hydrolyzing preference is GDP > IDP > UDP, but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate (By similarity).
Subcellular Location Endoplasmic reticulum, Secreted
Protein Families GDA1/CD39 NTPase family
Database Links

STRING: 9031.ENSGALP00000016566

UniGene: Gga.9865

Related Products

ENTPD5 Proteins

ENTPD5 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.