Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 8(ENTPD8)

Code CSB-CF007697CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O93295
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence MEYKGKVVAGLLTATCVFSIIALILSAVDVKDVFLPPGTKYGLVFDAGSTHTALYVYQWPADKENGTGIVSQVESCTVNGSGISSYADDPAGAGASLKPCLDKAMAVIPVEQQWQTPTYLGATAGMRLLREQNSTKAEQVFAEVSKAIREFPVDFRGAQILTGNEEGSFGWITVNYLLETLIKFSFAGKWEHPQNTEVLGALDLGGASTQITFQPGVTIEDKNTSVLFRLYGTNYSLYTHSYLCYGQIQASKRLMAALHQDGSYVQNISHPCYPKGYRRIITIAEIYDSPCVPTPSMLSPAQILTVTGTGNPAACPTAILKLFNLTCGANRTCGFDGVYQPPVRGQFFAFAGFYYTFSFLNLTGQQSLSHVNATVWDFCNKNWSELVETFPQNKEHLHTYCVVGLYILTLLVDGYKFDEHTWSNIHFSQKAGNADIGWTLGFMLNLTNMIPTEALEHVKGHEPSLWAGAISFIVLAIVAGLVAILLQCFWKSK
Source in vitro E.coli expression system
Gene Names ENTPD8
Protein Names Recommended name: Ectonucleoside triphosphate diphosphohydrolase 8 Short name= E-NTPDase 8 Short name= NTPDase 8 Short name= NTPDase8 EC= 3.6.1.5 Alternative name(s): Liver ecto-ATP diphosphohydrolase
Expression Region 1-493
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside ATPases catalyze the hydrolysis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families GDA1/CD39 NTPase family
Database Links

KEGG: gga:374095

STRING: 9031.ENSGALP00000014500

UniGene: Gga.49226

Related Products

ENTPD8 Proteins

ENTPD8 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.