Recombinant Chicken Pinopsin

Code CSB-CF341966CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P51475
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence MSSNSSQAPPNGTPGPFDGPQWPYQAPQSTYVGVAVLMGTVVACASVVNGLVIVVSICYK KLRSPLNYILVNLAVADLLVTLCGSSVSLSNNINGFFVFGRRMCELEGFMVSLTGIVGLW SLAILALERYVVVCKPLGDFQFQRRHAVSGCAFTWGWALLWSAPPLLGWSSYVPEGLRTS CGPNWYTGGSNNNSYILSLFVTCFVLPLSLILFSYTNLLLTLRAAAAQQKEADTTQRAER EVTRMVIVMVMAFLLCWLPYSTFALVVATHKGIIIQPVLASLPSYFSKTATVYNPIIYVF MNKQFQSCLLEMLCCGYQPQRTGKASPGTPGPHADVTAAGLRNKVMPAHPV
Source in vitro E.coli expression system
Protein Names Recommended name: Pinopsin Alternative name(s): Pineal gland-specific opsin Short name= P-opsin Short name= Pineal opsin
Expression Region 1-351
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produces a slow and prolonged phototransduction response consistent with the non-visual function of pineal photoreception.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Pineal gland.
Database Links

KEGG: gga:396377

STRING: 9031.ENSGALP00000007864

UniGene: Gga.786

Related Products

Proteins

Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.