Recombinant Chlorobium tepidum ATP synthase subunit a 2(atpB2)

Code CSB-CF818465DST
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8KGE7
Storage Buffer Tris-based buffer,50% glycerol
Species Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Sequence TSVQDESPVTGSAVEAVHTVPSTVAAPVAGHAEAAAGQAAKAEEKPGDLIMHHILDNSTF SFEPFGEVHLPHLEVAGFDISITKHVVMIWLAAILLVVIASAAGASVKKMSANQAPKGVA NVFESLVDFISNDVAKPNIGHGYEKFLPYLLTVFFFILVCNLLGLIPYGATATGNINVTL TLSVFTFVITQFSAFKAQGVKGYLQHLTAGTHWALWIIMVPIEILGQFTKPFALTIRLFA NMTAGHIIILSLFFISFILKSYIVAVAVSIPFAIFIYLLELFVAFLQAYVFTMLSALFIG LATAHSDSHDGHELEATARHGDGLTV
Source in vitro E.coli expression system
Gene Names atpB2
Protein Names Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2
Expression Region 27-352
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ATPase A chain family
Database Links

KEGG: cte:CT0021

STRING: 194439.CT0021

Related Products

atpB2 Proteins

atpB2 Proteins for Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.