Recombinant Chlorobium tepidum ATP synthase subunit a 2(atpB2)

Code CSB-CF818465DST
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8KGE7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Sequence TSVQDESPVTGSAVEAVHTVPSTVAAPVAGHAEAAAGQAAKAEEKPGDLIMHHILDNSTF SFEPFGEVHLPHLEVAGFDISITKHVVMIWLAAILLVVIASAAGASVKKMSANQAPKGVA NVFESLVDFISNDVAKPNIGHGYEKFLPYLLTVFFFILVCNLLGLIPYGATATGNINVTL TLSVFTFVITQFSAFKAQGVKGYLQHLTAGTHWALWIIMVPIEILGQFTKPFALTIRLFA NMTAGHIIILSLFFISFILKSYIVAVAVSIPFAIFIYLLELFVAFLQAYVFTMLSALFIG LATAHSDSHDGHELEATARHGDGLTV
Source in vitro E.coli expression system
Gene Names atpB2
Protein Names Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2
Expression Region 27-352
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ATPase A chain family
Database Links

KEGG: cte:CT0021

STRING: 194439.CT0021

Related Products

atpB2 Proteins

atpB2 Proteins for Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.